DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CTRB2

DIOPT Version :10

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001020371.3 Gene:CTRB2 / 440387 HGNCID:2522 Length:263 Species:Homo sapiens


Alignment Length:105 Identity:25/105 - (23%)
Similarity:41/105 - (39%) Gaps:14/105 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 EGAHKVAVCTTQMFEKMEFDVVKHYIFVDAPAEEKLRDQLRQKAVCEGKKIRVDLVMSESYEVS- 149
            ||..|....:....||...|:.|  :....|.....||..|:.||....:   ||...:.:.:. 
Human   601 EGGKKKKKRSRSRAEKRSGDLEK--LPASVPPSGSDRDSRRRGAVPPSIQ---DLTDHDLFAIKR 660

  Fly   150 -------VKVEEK-PAEASKPSPKRKCSFDIYSIKPNKQG 181
                   .|.|.: |:.|...||||:..:|...:..:::|
Human   661 TITVGRPDKAEPRAPSPAPAVSPKREVLYDSEGLSADERG 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 35..256 CDD:238113 25/105 (24%)
CTRB2NP_001020371.3 Tryp_SPc 34..259 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.