DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and KLK14

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001298111.2 Gene:KLK14 / 43847 HGNCID:6362 Length:251 Species:Homo sapiens


Alignment Length:235 Identity:68/235 - (28%)
Similarity:119/235 - (50%) Gaps:19/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DNRIVGGQEAEDGVAPYQVSIQT-IWKTHICSGVILNEQWILTAGHCALDFSIEDLRIIVGTND- 94
            :|:|:||........|:|.::.. ..:..:|.|.:|:.||::||.||....    |::.:|.:: 
Human    22 ENKIIGGHTCTRSSQPWQAALLAGPRRRFLCGGALLSGQWVITAAHCGRPI----LQVALGKHNL 82

  Fly    95 -RLE-PGQTLFPDEALVHCLYDIPYVYNNDIALIHVNESIIFNDRTQIVELSREQPPAGSTVTLT 157
             |.| ..|.|.....:.|..|: ...::||:.|:.:.:........:.:|:::.....|::..::
Human    83 RRWEATQQVLRVVRQVTHPNYN-SRTHDNDLMLLQLQQPARIGRAVRPIEVTQACASPGTSCRVS 146

  Fly   158 GWG---APESSYPTVQYLQTLNLTIIAHEECRERWDFHDGIDIGHICT-FTREGEGACSGDSGGP 218
            |||   :|.:.||.  .||.:|:.|...|.|::.  :...|..|.:|. ..:.|:.:|.||||||
Human   147 GWGTISSPIARYPA--SLQCVNINISPDEVCQKA--YPRTITPGMVCAGVPQGGKDSCQGDSGGP 207

  Fly   219 LMWEGKLVGLVNWG-RACGV-GMPDMYANTVYYQDWIRRT 256
            |:..|:|.|||:|| ..|.: |.|.:|.|...|:.||..|
Human   208 LVCRGQLQGLVSWGMERCALPGYPGVYTNLCKYRSWIEET 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 64/228 (28%)
Tryp_SPc 35..256 CDD:238113 66/230 (29%)
KLK14NP_001298111.2 Tryp_SPc 25..247 CDD:238113 66/230 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.