DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CG9737

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:298 Identity:74/298 - (24%)
Similarity:128/298 - (42%) Gaps:64/298 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IDVT---RGKRLDNR-----------------KLLDNRIVGGQEAEDGVAPYQVSIQTIWKTHIC 61
            :|||   :.|:|..|                 |.:.|||.||:.||....|:...:......:.|
  Fly   112 LDVTARFKRKKLKRRIQTVEPSSGFNLLNECGKQVTNRIYGGEIAELDEFPWLALLVYNSNDYGC 176

  Fly    62 SGVILNEQWILTAGHCALDFSIEDLR----IIVGT-NDRLEPGQTLFPD-----EALVHCLYDIP 116
            ||.:::::.||||.||.....:.|.:    :.:|. |.:.||.....|:     :|.:...|:..
  Fly   177 SGALIDDRHILTAAHCVQGEGVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKI 241

  Fly   117 YVY----------NNDIALIHVNESIIFNDRTQIVELSREQPP----AGSTVTLTGWGAPE---- 163
            :|:          .||||:|.:...:.|......:.|..:..|    .|...:::|||..:    
  Fly   242 HVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNK 306

  Fly   164 ---SSYPTVQYLQTLNLTIIAHEECRERWDFHDGIDIG--HICTFTREGEGACSGDSGGPLMWEG 223
               :.:..::.  .|.:..:::|.|.:..:.. |:.:|  .||......:..|:||||||||:..
  Fly   307 YFINIHSPIKL--KLRIPYVSNENCTKILEGF-GVRLGPKQICAGGEFAKDTCAGDSGGPLMYFD 368

  Fly   224 K------LVGLVNWG-RACGV-GMPDMYANTVYYQDWI 253
            :      ..|:|::| ..||: |.|.:|.|...|.|||
  Fly   369 RQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 64/259 (25%)
Tryp_SPc 35..256 CDD:238113 65/260 (25%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 64/259 (25%)
Tryp_SPc 150..409 CDD:238113 65/260 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.