DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CG11843

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:275 Identity:73/275 - (26%)
Similarity:126/275 - (45%) Gaps:38/275 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLGTSIDVTRGKRLDNRKLLDNRIVGGQEAEDGVAPYQV--------SIQTIWKTHICSGVILN 67
            ||.|.||:   .:.:||.:.....||||..|:....|:..        |.:..|   .|.||:::
  Fly    47 LLPGASIE---SRIIDNCRSYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADW---FCGGVLIS 105

  Fly    68 EQWILTAGHCALDFSIEDLRII-VGTNDRLEPGQTLFPDEALV-----HCLYDIPYVYNNDIALI 126
            |:::|||.|| |:....::.:: :|..|.....:...|.:.:|     |..|:.|..| :||.|:
  Fly   106 ERFVLTAAHC-LESERGEVNVVRLGELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFY-HDIGLV 168

  Fly   127 HVNESIIFNDRTQIVELSREQPPAGSTVTLTGWGAPESSY-PTVQYLQTLNLTIIAHEEC----- 185
            .:.|:::|:.......|..:...:..:....|||:...:. |:.|.|: :.|....:..|     
  Fly   169 KLTEAVVFDLYKHPACLPFQDERSSDSFIAVGWGSTGLALKPSAQLLK-VKLQRYGNWVCKKLLT 232

  Fly   186 RERWDFHDGID-IGHICTFTREGEGACSGDSGGPLMWEGK-------LVGLVNWGRACG-VGMPD 241
            |:..:|..|.| ...:|..:...:..|:|||||||:...:       :||:.:.|.:|| .|:|.
  Fly   233 RQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCGSPGIPG 297

  Fly   242 MYANTVYYQDWIRRT 256
            :|.....|..||.||
  Fly   298 IYTRVYPYLGWIART 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 62/247 (25%)
Tryp_SPc 35..256 CDD:238113 64/249 (26%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 64/249 (26%)
Tryp_SPc 68..309 CDD:214473 62/246 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.