DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CG10232

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:233 Identity:59/233 - (25%)
Similarity:100/233 - (42%) Gaps:49/233 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 THICSGVILNEQWILTAGHCALDFSI--EDL---RIIVGTNDRLEPGQTLFPD-EALVHCLYDIP 116
            |:.|||.::|::::|||.||.:...:  .||   |:.:|.:|     .|..|| :...:|.  .|
  Fly   285 TNNCSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRVRLGEHD-----ITTNPDCDFTGNCA--AP 342

  Fly   117 YV------------------YNNDIALIHVNESIIFNDRTQIVELSREQPPA-GSTVTLTGWGAP 162
            :|                  :.:||||:.:...:.:......:.:.::..|. ...:.:.|||..
  Fly   343 FVEIGIEYFNVHEQYFNTSRFESDIALVRLQTPVRYTHEILPICVPKDPIPLHNHPLQIAGWGYT 407

  Fly   163 ESSYPTVQYLQTL--NLTIIAHEECRERWDFHDGIDIGHICTFTREGEGACSGDSGGPLMWEGK- 224
            ::.    :|.|.|  |........|:::..|..  :...||.....||.:|.||||||||.... 
  Fly   408 KNR----EYSQVLLHNTVYENRYYCQDKISFFR--NESQICASGIRGEDSCEGDSGGPLMLTLNN 466

  Fly   225 -------LVGLVNWG-RACGVGMPDMYANTVYYQDWIR 254
                   |.|:|::| ..||...|.:|..|..:..||:
  Fly   467 DYQDIVYLAGIVSYGSENCGDRKPGVYTKTGAFFSWIK 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 57/230 (25%)
Tryp_SPc 35..256 CDD:238113 59/233 (25%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 59/233 (25%)
Tryp_SPc 260..503 CDD:214473 57/230 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.