DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CG31199

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:244 Identity:44/244 - (18%)
Similarity:87/244 - (35%) Gaps:81/244 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVRLSLIWLLLLGTSIDVTRGKRLDNRKLLDNRIVGGQEAEDGV----APYQVSIQTIWKTHI- 60
            |..|:::: |||:|..     |..:.:.|:.|::.  |...||.:    :.:.:..:..|...| 
  Fly     1 MLGRIAVL-LLLVGLF-----GPEVRSAKVNDDQC--GAFDEDQMLNMQSTFAIPTEHQWVARIV 57

  Fly    61 -------------CSGVILNEQWILTAGHCALDFS--IEDLRIIVGTNDR--------------- 95
                         |.||:::::.:|...||.:.::  .|...:.:|.:::               
  Fly    58 YGKGFEGKIRDNGCLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLGVHNKSAPVGVRVCETDGYC 122

  Fly    96 LEPGQTLFPDEALVHCLYDIPYVYNNDIALIH---------------------VNESI------- 132
            :.|.|.:...|..:|..|| .....|.:|::.                     :||::       
  Fly   123 VRPSQEIKLAEIAIHPDYD-SRTLKNSLAVLTLQRDAKIYPNVMPICMPPPSLLNETLVAQTFVV 186

  Fly   133 ----IFND---RTQIVELSRE--QPPAGSTVTLTGWGAPESSYPTVQYL 172
                :|.|   :|.:..|||.  |....:.||.:.........|...||
  Fly   187 AGLRVFEDFRLKTWVNTLSRGFCQSKVKTLVTSSNTVCGYHKQPVAYYL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 35/211 (17%)
Tryp_SPc 35..256 CDD:238113 35/210 (17%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 32/192 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.