DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CG31265

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:264 Identity:120/264 - (45%)
Similarity:164/264 - (62%) Gaps:14/264 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VRLSLIWLLLLGTSIDVTRGKRLDNRKLL-------DNRIVGGQEAEDGVAPYQVSIQTIWKTHI 60
            :||||:.||.      |......::::::       ..||.||:|||.|.||||||:|.|..:|.
  Fly     4 LRLSLLILLA------VKPPNPCESKRIVGPFPAGQSGRIKGGEEAEIGFAPYQVSLQPIVGSHN 62

  Fly    61 CSGVILNEQWILTAGHCALDFSIEDLRIIVGTNDRLEPGQTLFPDEALVHCLYDIPYVYNNDIAL 125
            |.|.||||.||:|||||..:|....:.:|.|||...|||...:..|...||:||.||:: |||||
  Fly    63 CGGAILNENWIITAGHCVENFIPALVNVITGTNKWAEPGAIYYTAEIHKHCMYDQPYMH-NDIAL 126

  Fly   126 IHVNESIIFNDRTQIVELSREQPPAGSTVTLTGWGAPESSYPTVQYLQTLNLTIIAHEECRERWD 190
            :.:.|:|.||:.||.:.|.......|..:.|||||:..:...:::.|..|.:.::..:||.|.::
  Fly   127 VKLTENITFNELTQPIALPTRPVQLGEEIVLTGWGSDVAYGSSMEDLHKLTVGLVPLDECYETFN 191

  Fly   191 FHDGIDIGHICTFTREGEGACSGDSGGPLMWEGKLVGLVNWGRACGVGMPDMYANTVYYQDWIRR 255
            ....:.:||||||:|||||||.|||||||:..|:|||:|||||.||||:||:.||..||.||||.
  Fly   192 RTSSMGVGHICTFSREGEGACHGDSGGPLVSNGQLVGVVNWGRPCGVGLPDVQANVYYYLDWIRS 256

  Fly   256 THSG 259
            ..||
  Fly   257 KLSG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 108/218 (50%)
Tryp_SPc 35..256 CDD:238113 110/220 (50%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 108/218 (50%)
Tryp_SPc 39..257 CDD:238113 109/218 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 213 1.000 Domainoid score I5955
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D104368at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9706
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.120

Return to query results.
Submit another query.