DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and modSP

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:268 Identity:63/268 - (23%)
Similarity:91/268 - (33%) Gaps:73/268 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GGQEAEDGVAPYQVSIQTIWKT----HI-CSGVILNEQWILTAGHCALD------FSIEDLRIIV 90
            ||....:.|.|:.|.:. :|..    |. |.|.:|....::||.||..|      :|.:..|:|.
  Fly   371 GGYTINNTVVPWHVGLY-VWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIA 434

  Fly    91 GTNDRLEPGQTLFPDEALVHCLYDIPYV------------YNNDIALIHVNESIIFNDRTQIVEL 143
            ....| ..|:|. |:|.    ..|:..:            |..|:||:.::|..         ||
  Fly   435 AKFYR-NYGETT-PEEK----RRDVRLIEIAPGYKGRTENYYQDLALLTLDEPF---------EL 484

  Fly   144 SREQPPAGSTVTLTGWGAPESSYPTVQ------------YLQTLNLTIIAHEECRERWDFHDGID 196
            |....|.  .||...:...||....||            .||.:.....::..||.  :..| |.
  Fly   485 SHVIRPI--CVTFASFAEKESVTDDVQGKFAGWNIENKHELQFVPAVSKSNSVCRR--NLRD-IQ 544

  Fly   197 IGHICTFTREGEGACSGDSGGPLMWEGKLVGLVNWGRA----------------CGVGMPDMYAN 245
            ....|.||:....||.|||||....|........|..|                |...:..| .|
  Fly   545 ADKFCIFTQGKSLACQGDSGGGFTSELPTNAFSTWNTARHFLFGVISNAPNADQCAHSLTVM-TN 608

  Fly   246 TVYYQDWI 253
            ..:::|.|
  Fly   609 IQHFEDMI 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 62/266 (23%)
Tryp_SPc 35..256 CDD:238113 63/268 (24%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 62/266 (23%)
Tryp_SPc 371..591 CDD:304450 58/240 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.