DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CG3505

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:285 Identity:79/285 - (27%)
Similarity:113/285 - (39%) Gaps:77/285 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WLLLLGTSIDVTRGKRLDNRKLLDNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWILT 73
            ||.|    |:.||               |.||                |.|.|.||:::::::||
  Fly   120 WLAL----IEYTR---------------GNQE----------------KIHACGGVLISDRYVLT 149

  Fly    74 AGHCALDFSIEDLRII--------VGTN------------DRLEPGQTLFPDEALVHCLYD-IPY 117
            |.||....:..:|:|.        ..||            |...|.|.:..:|.|.|.||: ...
  Fly   150 AAHCVAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDR 214

  Fly   118 VYNNDIALIHVNESIIFNDRTQIVELSREQPPAGS----TVTLTGWGAPESSYPTVQYLQTLNLT 178
            ...|||||:.:......||..|.:.|..:|..|..    ...:.||.|..|     |.::...:|
  Fly   215 TQINDIALVRLASPAKLNDFVQPICLPNKQLRADELEDLVTEVAGWQASSS-----QRMRKGYVT 274

  Fly   179 IIAHEECRERWDFHD-GIDIGHICTFTREGEGACSGDSGGPLMW---EGKLV-GLVNWGRA-C-G 236
            |.:.|||:.::.... .|....:|..|...|  |.|::|||||.   :|.|: |||::|.. | .
  Fly   275 ISSIEECQRKYASQQLRIQASKLCGLTNSQE--CYGNAGGPLMLFKNDGYLLGGLVSFGPVPCPN 337

  Fly   237 VGMPDMYANTVYYQDWIRRTHSGCK 261
            ...||:|.....|.|||   |...|
  Fly   338 PDWPDVYTRVASYIDWI---HDSLK 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 69/250 (28%)
Tryp_SPc 35..256 CDD:238113 71/252 (28%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 77/280 (28%)
Tryp_SPc 111..354 CDD:214473 75/275 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.