DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CG9649

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:247 Identity:68/247 - (27%)
Similarity:113/247 - (45%) Gaps:33/247 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IVGGQEAEDGVAPYQVSI-QTIWKTH--ICSGVILNEQWILTAGHCALDFSIEDL---RIIV--G 91
            |..|.|.|.|..|:..:: :.:.:.:  :|.|.:::.:.:::|.|| ..|...:|   |.||  |
  Fly   257 IHNGIEVERGQLPWMAALFEHVGRDYNFLCGGTLISARTVISAAHC-FRFGSRNLPGERTIVSLG 320

  Fly    92 TN--DRLEPGQTLFPDEALVHCLYDIPYVYNN-DIALIHVNESIIFNDRTQIVELSRE----QPP 149
            .|  |....|.||.....|:|..|: |.||.: |:||:.::..:...|..:.:.|..|    :.|
  Fly   321 RNSLDLFSSGATLGVARLLIHEQYN-PNVYTDADLALLQLSNHVDIGDYIKPICLWNENFLLELP 384

  Fly   150 AGSTVTLTGWGAPESSYPTVQYLQTLNLTIIAHEECR-----ERWDFHDGIDIGHICTFTREGEG 209
            :|....:.|||..|......:..:..:..||...|||     |...|   |....||....:..|
  Fly   385 SGHKSYVAGWGEDEKGNRNTRLAKMTDTDIITQWECRGNLSEENAKF---ITSHTICASNAQASG 446

  Fly   210 ACSGDSGGPLMWEGK----LVGLVNWGR----ACGVGMPDMYANTVYYQDWI 253
            .|||||||.||.:.:    |.|:|:.|:    .|.:.:|.:|.:...:.:|:
  Fly   447 PCSGDSGGGLMLQEQDIWMLRGVVSAGQRMTNRCNLTLPVIYTDVAKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 67/245 (27%)
Tryp_SPc 35..256 CDD:238113 68/247 (28%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 67/245 (27%)
Tryp_SPc 259..497 CDD:214473 66/242 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.