DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CG8870

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:231 Identity:59/231 - (25%)
Similarity:96/231 - (41%) Gaps:46/231 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 CSGVILNEQWILTAGHCALDFSIEDLRIIVGTNDRLEPGQTLFPDEALVH------CLY---DIP 116
            |.|.::|..::|||.|| :::...|....:.|....|...:..||.|:|:      .||   ::.
  Fly   117 CGGSLINNWYVLTAAHC-VEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVD 180

  Fly   117 YV-----YN------NDIALIHVNESIIFNDRTQIVELSREQPPAGSTVTLTGWGAPESSYPTVQ 170
            .:     :|      |||||:.:...:.:....|.:.|.|.|..|.........|.|:.......
  Fly   181 QIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICLPRAQKLAAHKRKFQASGWPDMGQGIAS 245

  Fly   171 YLQTLNLTIIAH---EECRERWDFHDGIDIGHICTFTREGEGACSGDSGGPLM---WEGKL---- 225
              :.|..:.||.   :.|:..:||:.|   ..||....:|.....||||||||   ..||:    
  Fly   246 --EVLLRSFIAERHPDVCKSNYDFNLG---SQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTY 305

  Fly   226 -VGLVNWG------RACGVGMPDMYANTVYYQDWIR 254
             .|::::|      :.|   .|..|..|.|:.:||:
  Fly   306 AAGIISYGQKPCVLKTC---KPAFYTKTSYFFEWIK 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 57/228 (25%)
Tryp_SPc 35..256 CDD:238113 59/231 (26%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 59/231 (26%)
Tryp_SPc 93..337 CDD:214473 57/228 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.