DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CG3916

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:243 Identity:84/243 - (34%)
Similarity:121/243 - (49%) Gaps:38/243 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGQEAEDGVAPYQVSIQT----IWKTHICSGVILNEQWILTAGHCALDFSIEDLRIIVGTND 94
            ||.|||...:.| |:|||:|.    .|: |.|.|.|::.|.:|||.||.....:||:.::|||.:
  Fly    30 RINGGQRVNETV-PFQVSLQMQRRGRWQ-HFCGGSIVSGQHVLTAAHCMEKMKVEDVSVVVGTLN 92

  Fly    95 RLEPGQTLFPDEALVHCLYDIPYVYNNDIALIHVN----------ESIIFNDRTQIVELSREQPP 149
            ....|.........||..|.:.....|||||:.|.          .:|:.....:|    .|:.|
  Fly    93 WKAGGLRHRLVTKHVHPQYSMNPRIINDIALVKVTPPFRLERSDISTILIGGSDRI----GEKVP 153

  Fly   150 AGSTVTLTGWG--APESSYPTV-QYLQTLNLTIIAHEECRERWDFHDGIDI--GHICTFTREGEG 209
                |.|||||  :|.:|..|: ..||.||...|::|:|.::     |..:  ..||....:|:|
  Fly   154 ----VRLTGWGSTSPSTSSATLPDQLQALNYRTISNEDCNQK-----GFRVTRNEICALAVQGQG 209

  Fly   210 ACSGDSGGPLMWEGK---LVGLVNWGRA-CGVGMPDMYANTVYYQDWI 253
            ||.|||||||:..||   |||:|::|.: |..|.||:|.....:..:|
  Fly   210 ACVGDSGGPLIRPGKQPHLVGIVSYGSSTCAQGRPDVYTRVSSFLPYI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 83/241 (34%)
Tryp_SPc 35..256 CDD:238113 83/242 (34%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 83/241 (34%)
Tryp_SPc 31..260 CDD:238113 83/242 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449466
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.