DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CG16749

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:236 Identity:78/236 - (33%)
Similarity:119/236 - (50%) Gaps:17/236 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWILTAGHCALDFSIEDLRIIVGTNDRLEP 98
            |:|.|.::.....|:.:|::....:|.|.|.|:::|:::||.||.......||.:..|.......
  Fly    29 RVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKASDLSVQYGVTKINAT 93

  Fly    99 GQTLFPDEALV-HCLYDIPY-VYNNDIALIHVNESIIFNDRT----QIVEL--SREQPPAGSTVT 155
            |..:...:.:: |..|: || .|.|||:|:.|.|...|:..|    ::.||  :..|..||....
  Fly    94 GPNVVRVKKIIQHEDYN-PYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAGGEGV 157

  Fly   156 LTGWGAPESSYPTVQYLQTLNLTIIAHEECRERWDFHDGIDIG--HICTFTRE-GEGACSGDSGG 217
            |.|||...:.......||.:.|.:.:.|||.||   |.|....  |||....| |:|.|||||||
  Fly   158 LIGWGLNATGGYIQSTLQEVELKVYSDEECTER---HGGRTDPRYHICGGVDEGGKGQCSGDSGG 219

  Fly   218 PLMWEGKLVGLVNWG-RACGVG-MPDMYANTVYYQDWIRRT 256
            ||::.|:.||:|:|. :.|.|. .|.:|.....|.|||:::
  Fly   220 PLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKKS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 76/231 (33%)
Tryp_SPc 35..256 CDD:238113 77/233 (33%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 76/231 (33%)
Tryp_SPc 30..259 CDD:238113 77/232 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.