DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:232 Identity:71/232 - (30%)
Similarity:119/232 - (51%) Gaps:15/232 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWILTAGHCAL-DFSIEDLRIIVGTNDRL 96
            :::.|||:||:|..|:|.|:|.. ..|.|...:::..|::||.||.: ..:.:|.::..|.. ..
  Rat   185 HKVAGGQDAEEGEWPWQASLQQN-NVHRCGATLISNSWLITAAHCFVRSANPKDWKVSFGFL-LS 247

  Fly    97 EPGQTLFPDEALVHCLYDIPYVYNNDIALIHVNESIIFND---RTQIVELSREQPPAGSTVTLTG 158
            :|.........::|..|..| .:|||||::.::..:::.:   |..:.|.:::.|| .|.|.:||
  Rat   248 KPQAQRAVKSIVIHENYSYP-AHNNDIAVVRLSSPVLYENNIRRACLPEATQKFPP-NSDVVVTG 310

  Fly   159 WGAPESSYPTVQYLQTLNLTIIAHEECRERWDFHDGIDIGHICTFTREGE-GACSGDSGGPLMWE 222
            ||..:|...:...||...:.||.::.|.....:...|..|.:|....||. .||.|||||||:.|
  Rat   311 WGTLKSDGDSPNILQKGRVKIIDNKTCNSGKAYGGVITPGMLCAGFLEGRVDACQGDSGGPLVSE 375

  Fly   223 GK-----LVGLVNWGRACGV-GMPDMYANTVYYQDWI 253
            ..     |.|:|:||..|.: ..|.:|....:|:|||
  Rat   376 DSKGIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 69/229 (30%)
Tryp_SPc 35..256 CDD:238113 71/230 (31%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 69/229 (30%)
Tryp_SPc 187..415 CDD:238113 71/230 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.