DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and Tryx5

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_006236430.1 Gene:Tryx5 / 408205 RGDID:1302947 Length:251 Species:Rattus norvegicus


Alignment Length:256 Identity:57/256 - (22%)
Similarity:104/256 - (40%) Gaps:63/256 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GGQEAEDGV-----APYQVSIQTIWKTHICSGVILNEQWILTAGHCALDFSIEDLRI-IVGTNDR 95
            |.|::::.:     .||...:::  ....|.|.:::..|:|||.||:|...|   |: :...|.:
  Rat    24 GDQDSDEYLPENFNVPYMAYLKS--SPEPCVGTLIDPLWVLTAAHCSLPTKI---RLGVYRPNIK 83

  Fly    96 LEPGQTLFPDEALVHCLYDIPYVYNNDIALIHVN----------------ESIIFNDRTQIVELS 144
            .|..|.......:||..:| ..:..||:.||.::                |.::||:...|    
  Rat    84 NEKEQIHGYSLTVVHPNFD-ANIRKNDLMLIKLSYPATIDMYVGTIAIAMEPMVFNETCFI---- 143

  Fly   145 REQPPAGSTVTLTGWGAPESSYPTVQYLQTLNLTIIAHEEC-----RERWDFHDGI-DIGH---I 200
                |..:......:..|::...|.||.:       :..:|     ::|.:....| .|||   :
  Rat   144 ----PTWTWNHYNNYSDPDTLTWTNQYSR-------SPSDCWNTLHQQRQETRINIMCIGHSFNV 197

  Fly   201 CTFTREGEGACSGDSGGPLMWEGKLVGLVNWGRACGV--GMPDMYANTVYYQDWIRRT-HS 258
            .:.|:|       .|..|.:..|::.|:::||:| |:  |....:.....|..||.|. ||
  Rat   198 KSSTKE-------VSAAPAICSGRVHGILSWGKA-GITNGSEGFFTEIHPYARWILRVMHS 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 52/248 (21%)
Tryp_SPc 35..256 CDD:238113 54/251 (22%)
Tryx5XP_006236430.1 Tryp_SPc 37..244 CDD:419748 50/235 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341250
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.