DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and MP1

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:293 Identity:76/293 - (25%)
Similarity:122/293 - (41%) Gaps:70/293 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TRGKRLDNRKLL----------DNRIVGGQEAEDGVAPYQVSIQTI----WKTHICSGVILNEQW 70
            |:..:....|||          .:|:|||.|......|:...|:..    .|.|.|.|.::|.::
  Fly   113 TKPTKRSGTKLLPMAPNCGENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRY 177

  Fly    71 ILTAGHCA----LDFSIEDLRI-----------IVGTNDRLEPGQTL--FP-DEALVHCLYDIP- 116
            :|||.||.    .|:.:..:|:           .||.|.|.:..:..  :| :|.:.|     | 
  Fly   178 VLTAAHCVSAIPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPH-----PQ 237

  Fly   117 YVYN-----NDIALIHVNESIIFNDRTQIVELSREQPPA----------GSTVTLTGWGAPESSY 166
            |..|     |||||:.:.:.:.::|....|.|     |.          |..|.:.|||..|:::
  Fly   238 YPGNSRDQLNDIALLRLRDEVQYSDFILPVCL-----PTLASQHNNIFLGRKVVVAGWGRTETNF 297

  Fly   167 PTVQYLQTLNLTIIAHEECRERW-DFHDGIDIGHICTFTREGEGACSGDSGGPLMWEG------- 223
            .:...|:. .|..:...||.:|: .....:....:|....||..:|.|||||||:.|.       
  Fly   298 TSNIKLKA-ELDTVPTSECNQRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSN 361

  Fly   224 -KLVGLVNWG-RACGV-GMPDMYANTVYYQDWI 253
             .:.|:|::| ..||: |.|.:|.....|.:||
  Fly   362 YYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWI 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 70/267 (26%)
Tryp_SPc 35..256 CDD:238113 71/268 (26%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 70/267 (26%)
Tryp_SPc 138..397 CDD:238113 71/268 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.