DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CG7542

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:273 Identity:82/273 - (30%)
Similarity:126/273 - (46%) Gaps:43/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIWLLLLG--TSIDVTRGKRLDNRKLLDNRIVGGQEAEDGVAPYQVSIQTI---WKTHICSGVIL 66
            |:.:||:|  |::.:...        ::..|..|:.||.|..|||..:...   |.|. |.|.::
  Fly     5 LVCVLLVGSCTAVPLLTD--------VEPYITNGEPAEVGQFPYQAGLNVSFGNWSTW-CGGTLI 60

  Fly    67 NEQWILTAGHCALDFSIEDLRIIVGT---NDRLEPGQTLFPDE---ALVHCLYDIPYVYNNDIAL 125
            :..||:||.|| :| ..|.:.:.:|.   .|..|.||.....|   .:||..|....|. |||:|
  Fly    61 SHYWIITAAHC-MD-GAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVV-NDISL 122

  Fly   126 IHVNESIIFNDRTQIVELSRE---QPPAGSTVT--LTGWG----APESSYPTVQYLQTLNLTIIA 181
            |.:...:.|.||.:...|.|.   |.|...::.  .:|||    |.:|..|.::|::   :.|:.
  Fly   123 IRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVE---MPIMP 184

  Fly   182 HEECRERWDFHDGIDIGHICTFTREGEGACSGDSGGPLMWE----GKLVGLVNWGRA--CGVGMP 240
            |..||..|.  ..:....||..|..|:..|.|||||||:::    ..|:|..::|.:  |.||.|
  Fly   185 HSLCRMYWS--GAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFP 247

  Fly   241 DMYANTVYYQDWI 253
            .::.....|.|||
  Fly   248 AVFTRISSYLDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 75/242 (31%)
Tryp_SPc 35..256 CDD:238113 77/243 (32%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 77/243 (32%)
Tryp_SPc 27..260 CDD:214473 75/241 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.