DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CG11529

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:223 Identity:71/223 - (31%)
Similarity:118/223 - (52%) Gaps:25/223 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PYQVSI--QTIWKTHI-CSGVILNEQWILTAGHCALDFSIEDLRIIVGT----NDRLEPGQTLFP 104
            ||||.:  :.:|:..| |.|.:|:::||||||||.:..:..|  :.:||    :..:..|..|..
  Fly    42 PYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYD--VYLGTKSVEDTEVSGGLVLRS 104

  Fly   105 DEALVHCLYDIPYVYNNDIALIHVNESIIFNDRTQIVELS---REQPPAGSTVTLTGWGA--PES 164
            ::.:||..:: |....|||||:.:.:.:.|..|.|...|.   |....||.:|..:||||  ..:
  Fly   105 NKFIVHERFN-PETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQFAGMSVVASGWGAMVEMT 168

  Fly   165 SYPTVQYLQTLNLTIIAHEECRERWDFHDGIDIGHICTFTREGEGACSGDSGGPLMWEGK--LVG 227
            :..::||.:   |.:|::.||.:.:|.   :..|.||....:.|..|:|||||||:.:..  :||
  Fly   169 NSDSMQYTE---LKVISNAECAQEYDV---VTSGVICAKGLKDETVCTGDSGGPLVLKDTQIVVG 227

  Fly   228 LVNWGRA--CGVGMPDMYANTVYYQDWI 253
            :.::|.|  |...:|..:....:|.|||
  Fly   228 ITSFGPADGCETNIPGGFTRVTHYLDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 69/221 (31%)
Tryp_SPc 35..256 CDD:238113 71/223 (32%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 71/223 (32%)
Tryp_SPc 37..255 CDD:214473 69/221 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.