DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CG3088

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:273 Identity:71/273 - (26%)
Similarity:111/273 - (40%) Gaps:58/273 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLGTSIDVTRGKRLDNRKLLDNRIVGGQEAEDGVAPYQVSI----QTIWKTHICSGVILNEQW 70
            ::.||.:: |..|....:.:..|:.|..|..|.:|.|||.|.:    ..||    |||.|:.:.|
  Fly     5 VVFLGLTL-VAAGSAKKDSEDPDHIITNGSPAYEGQAPYVVGMAFGQSNIW----CSGTIIGDTW 64

  Fly    71 ILTAGHC------------ALDFSIEDLRIIVGTNDRLEPGQTLFPDEALVHCLYDIPYVYNND- 122
            |||:..|            |...|.....:.|||::                      ||..|. 
  Fly    65 ILTSAQCLTGSSGVTIYFGATRLSQAQFTVTVGTSE----------------------YVTGNQH 107

  Fly   123 IALIHVNESIIFNDRTQIVEL----SREQPPAGSTVTLTGWGAPESSYPTVQYLQTLNLTIIAHE 183
            :||:.| ..:.|::|...|.|    :|.|........:.|||....|......||.::|.|:::.
  Fly   108 LALVRV-PRVGFSNRVNRVALPSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNN 171

  Fly   184 ECRERWDFHDGIDIGH--ICTFTREGEGACSGDSGGPLM--WEGKLVGLVNW--GRACGVGMPDM 242
            ||..   |:....:..  :||.|..|...|.||:|.||:  .:..:||:..:  ...|.:|:|..
  Fly   172 ECIA---FYGSTTVSDQILCTRTPSGRSTCFGDAGSPLITKQDSTVVGISAFVASNGCTLGLPAG 233

  Fly   243 YANTVYYQDWIRR 255
            :|......|||.:
  Fly   234 FARITSALDWIHQ 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 64/245 (26%)
Tryp_SPc 35..256 CDD:238113 66/248 (27%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 66/246 (27%)
Tryp_SPc 29..244 CDD:214473 64/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.