DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and Jon65Ai

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:285 Identity:78/285 - (27%)
Similarity:115/285 - (40%) Gaps:65/285 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSLIWLLLLGTSI------------DVTRGKRLDNRKLLDNRIVGGQEAEDGVAPYQVSI----- 52
            :.::.:||||...            ||..||     ..::.||..|..|.:|..||.|.:     
  Fly     1 MKVLAVLLLGVIASATAFEKPVFWKDVPVGK-----ASIEGRITMGYPAYEGKVPYIVGLGFSKN 60

  Fly    53 -QTIWKTHICSGVILNEQWILTAGHCALDFSIEDLRIIVGTNDRLEP------GQTLFPDEALVH 110
             ...|    |.|.|:...|::||.||.  ..:|.:.|..|...||:.      |::.|.:..   
  Fly    61 GGGTW----CGGSIIGNTWVMTAKHCT--DGMESVTIYYGALWRLQAQYTHWVGRSDFIEHG--- 116

  Fly   111 CLYDIPYVYNNDIALI---HVNESIIFNDRTQIVELSREQPP----AGSTVTLTGWGAPESSYPT 168
                     :.||:||   ||:...:.|.    |||.|....    .|....::|||........
  Fly   117 ---------SGDISLIRTPHVDFWSLVNK----VELPRYDDRYNNYQGWWALVSGWGKTSDEGGV 168

  Fly   169 VQYLQTLNLTIIAHEECRERWDFHDGIDIGHICTFTREGEGACSGDSGGPLMWE--GKLVGLVNW 231
            .:||..:::.|..:..|...:....| |:  ||..|.|.:|.|||||||||:..  .:.||:|::
  Fly   169 SEYLNCVDVQIGENSVCENYYGSFSG-DL--ICIPTPENKGTCSGDSGGPLVIHDGNRQVGIVSF 230

  Fly   232 GRACGV--GMPDMYANTVYYQDWIR 254
            |.:.|.  ..|........|.||||
  Fly   231 GSSAGCLSNGPKGMVRVTSYLDWIR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 67/241 (28%)
Tryp_SPc 35..256 CDD:238113 69/243 (28%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 67/241 (28%)
Tryp_SPc 41..257 CDD:238113 68/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.