DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:254 Identity:73/254 - (28%)
Similarity:108/254 - (42%) Gaps:43/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LDNRIVGGQEAEDGVAPYQVSIQ------TIWKTHICSGVILNEQWILTAGHCALDFSIEDLRII 89
            ::.||..|:.|..|..||||.:.      :.|    |.|.|::..|:|||.||....|.  :.|.
  Fly    36 IEGRITNGKTATSGQFPYQVGLSFASTSGSWW----CGGSIIDNTWVLTAAHCTSGASA--VTIY 94

  Fly    90 VGTNDRLEPG--QTLFPDEALVHCLYDIPYVYNNDIALIHVNESIIFNDRTQIVELSREQPPA-- 150
            .|...|....  ||:..|..:.|..|: ..|..|||:||. ..::.|......|||     ||  
  Fly    95 YGATVRTSAQLVQTVSADNFVQHASYN-SIVLRNDISLIK-TPTVAFTALINKVEL-----PAIA 152

  Fly   151 -------GSTVTLTGWGAPESSYPTV-QYLQTLNLTIIAHEECRERWDFHDGIDIGH---ICTFT 204
                   |.....:|||....|..:| ..||.....:::..:|:..:    |..:..   ||..|
  Fly   153 GTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQCQNTY----GSLVATNNVICVAT 213

  Fly   205 REGEGACSGDSGGPLMW--EGKLVGLVNW--GRACGVGMPDMYANTVYYQDWIRRTHSG 259
            ......|:|||||||:.  :.||:|:.::  ...|..|.|..:.....|.||| :|::|
  Fly   214 PNKVSTCNGDSGGPLVLVSDSKLIGVTSFVSSAGCESGAPAGFTRVTSYLDWI-KTNTG 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 69/243 (28%)
Tryp_SPc 35..256 CDD:238113 70/245 (29%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 69/243 (28%)
Tryp_SPc 40..269 CDD:238113 70/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.