DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and KLK1

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_002248.1 Gene:KLK1 / 3816 HGNCID:6357 Length:262 Species:Homo sapiens


Alignment Length:258 Identity:82/258 - (31%)
Similarity:125/258 - (48%) Gaps:53/258 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LDNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWILTAGHCALDFSIEDLRIIVGTNDR 95
            :.:|||||.|.|....|:|.::.. :.|..|.|::::.||:|||.||..|            |.:
Human    21 IQSRIVGGWECEQHSQPWQAALYH-FSTFQCGGILVHRQWVLTAAHCISD------------NYQ 72

  Fly    96 LEPGQ-TLFPDE---ALVHCLYDIPYV-----------------YNNDIALIHVNE-SIIFNDRT 138
            |..|: .||.||   ..||.....|:.                 |::|:.|:.:.| :....|..
Human    73 LWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAV 137

  Fly   139 QIVELSREQPPAGSTVTLTGWGA--PES-SYPTVQYLQTLNLTIIAHEECRER-----WDFHDGI 195
            ::|||..|:|..|||...:|||:  ||: |:|  ..||.::|.|:.::||::.     .||.  :
Human   138 KVVELPTEEPEVGSTCLASGWGSIEPENFSFP--DDLQCVDLKILPNDECKKAHVQKVTDFM--L 198

  Fly   196 DIGHICTFTREGEGACSGDSGGPLMWEGKLVGLVNWGRA-CGV-GMPDMYANTVYYQDWIRRT 256
            .:||:    ..|:..|.||||||||.:|.|.|:.:||.. ||. ..|.:....:.|..||..|
Human   199 CVGHL----EGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDT 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 79/250 (32%)
Tryp_SPc 35..256 CDD:238113 80/252 (32%)
KLK1NP_002248.1 Tryp_SPc 25..257 CDD:238113 80/252 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147492
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.