DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CG30283

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:242 Identity:61/242 - (25%)
Similarity:106/242 - (43%) Gaps:36/242 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWILTAGHCALDFSIEDLRIIVGTNDRLEP 98
            :|:||..|....||:...:......| |.|.::..:::||:.||..:   .:|::.:|..:|...
  Fly    42 KILGGHNAPVASAPWMAMVMGEGGFH-CGGTLITNRFVLTSAHCIAN---GELKVRLGVLEREAE 102

  Fly    99 GQTLFPDEALVHCLYDIPYVYNNDIALIHVNESIIFNDRTQIVELSREQPPAGSTV-------TL 156
            .|....|...||..|   |...:|:||:.:.:.:.::|....:.|..:  |....:       ..
  Fly   103 AQKFAVDAMFVHTDY---YFDQHDLALLRLAKRVHYSDNISPICLLLD--PLVKNIDEHIVKFRT 162

  Fly   157 TGWGAPESSYPTVQYLQTLNLTIIAHEECRERWDFHDGIDIGHICTFTREGEGACSGDSGGPLMW 221
            .|||..||. .:.:.||..:|..:...||.:::. |..|:..|||..:... ..|:|||||||. 
  Fly   163 YGWGKTESR-SSSRMLQKTSLFNLHRSECAKQYP-HQQINRNHICAESANA-NTCNGDSGGPLT- 223

  Fly   222 EGKLV-----------GLVNWGRA-CGVGMPDMYANTVYYQDWIRRT 256
              .:|           |:.::|.| |  ....::.|.:.:.|||..|
  Fly   224 --AIVTYDHVQMVFQFGVTSFGHADC--SKATVFTNVMTHLDWIVNT 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 58/237 (24%)
Tryp_SPc 35..256 CDD:238113 60/239 (25%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 58/237 (24%)
Tryp_SPc 43..266 CDD:238113 60/239 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.