DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and Tmprss4

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_038937788.1 Gene:Tmprss4 / 367074 RGDID:1305033 Length:478 Species:Rattus norvegicus


Alignment Length:248 Identity:75/248 - (30%)
Similarity:108/248 - (43%) Gaps:38/248 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RKLLDNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWILTAGHCALDF-SIEDLRIIVG 91
            :.|...|:|||.||.....|:||||| ..|.|:|.|.||:..|||||.||...: .:...::..|
  Rat   239 KSLKTTRVVGGVEASADSWPWQVSIQ-YNKQHVCGGSILDHHWILTAAHCFRKYLDVSSWKVRAG 302

  Fly    92 TNDR-------------LEPGQTLFPDEALVHCLYDIPYVYNNDIALIHVNESIIFND--RTQIV 141
            :|..             .|| ..|.|.|              .||||:.:...:.|:.  |...:
  Rat   303 SNKLGNSPSLPVAKIFIAEP-NPLQPKE--------------KDIALVKLKMPLTFSGSVRPICL 352

  Fly   142 ELSREQPPAGSTVTLTGWG-APESSYPTVQYLQTLNLTIIAHEECRERWDFHDGIDIGHICTFTR 205
            ..|.|:......|.:.||| ..|:.......|...::.:|....|.....:...:..|.:|..|.
  Rat   353 PFSDEELIPTMPVWVIGWGFTEENGGKMSDTLLQASVQVIDSARCNAEDAYQGEVTAGMLCAGTP 417

  Fly   206 E-GEGACSGDSGGPLMW---EGKLVGLVNWGRACG-VGMPDMYANTVYYQDWI 253
            : |:..|.||||||||:   :.::||:|:||..|| ...|.:|.....|.|||
  Rat   418 QGGKDTCQGDSGGPLMYHYDKWQVVGIVSWGYGCGSPSTPGVYTKVTAYLDWI 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 72/240 (30%)
Tryp_SPc 35..256 CDD:238113 73/241 (30%)
Tmprss4XP_038937788.1 LDLa 99..133 CDD:238060
SRCR_2 149..238 CDD:413346
Tryp_SPc 245..470 CDD:214473 72/240 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341254
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.