DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and Prss3

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001102096.1 Gene:Prss3 / 362347 RGDID:1311446 Length:246 Species:Rattus norvegicus


Alignment Length:267 Identity:77/267 - (28%)
Similarity:128/267 - (47%) Gaps:43/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SLIWLLLLGTSIDVTRGKRLDNRKLLDNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQW 70
            :|::|.|:|.::...    :|:    |::||||...::...|||||:.:.:  |.|.|.::|:||
  Rat     3 ALLFLALVGVAVAFP----VDD----DDKIVGGYTCQENSVPYQVSLNSGY--HFCGGSLINDQW 57

  Fly    71 ILTAGHC-----ALDFSIEDLRIIVGTNDRLEPGQTLFPDEALVHCLYDIPYV------YNNDIA 124
            :::|.||     .:.....::.::.|             ||..|:....|.:.      .||||.
  Rat    58 VVSAAHCYKTRIQVRLGEHNINVLEG-------------DEQFVNAAKIIKHPNFNARNLNNDIM 109

  Fly   125 LIHVNESIIFNDRTQIVELSREQPPAGSTVTLTGWGAPES---SYPTVQYLQTLNLTIIAHEECR 186
            ||.::..:..|.|...|.|.....|||:...::|||...|   :.|.:  ||.|:..::...:|.
  Rat   110 LIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSLGVNNPDL--LQCLDAPVLPQADCE 172

  Fly   187 ERWDFHDGIDIGHICT-FTREGEGACSGDSGGPLMWEGKLVGLVNWGRACGV-GMPDMYANTVYY 249
            .  .:...|....||. |...|:.:|.||||||::..|:|.|:|:||..|.: ..|.:|.....|
  Rat   173 A--SYPGKITNNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNY 235

  Fly   250 QDWIRRT 256
            .|||:.|
  Rat   236 VDWIQDT 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 68/234 (29%)
Tryp_SPc 35..256 CDD:238113 70/236 (30%)
Prss3NP_001102096.1 Tryp_SPc 23..239 CDD:214473 68/234 (29%)
Tryp_SPc 24..242 CDD:238113 70/236 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.