DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and etaTry

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster


Alignment Length:240 Identity:77/240 - (32%)
Similarity:118/240 - (49%) Gaps:24/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DNRIVGGQEAEDGVAPYQVSI-----------QTIWKTHICSGVILNEQWILTAGHCALDFSIED 85
            |.|||||.:.......|.|.:           ||      |.|.||:...|.||.||..:...|:
  Fly    25 DGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQT------CGGCILDAVTIATAAHCVYNREAEN 83

  Fly    86 LRIIVGTNDR-LEPGQTLFPDEALVHCLYDIPYVYNNDIALIHVNESIIFN--DRTQIVELSREQ 147
            ..::.|.:.| ...|..:...:.:.|.||: ....:|||||:.|:..:..:  ...:.:|::.||
  Fly    84 FLVVAGDDSRGGMNGVVVRVSKLIPHELYN-SSTMDNDIALVVVDPPLPLDSFSTMEAIEIASEQ 147

  Fly   148 PPAGSTVTLTGWGAPESSYPTVQYLQTLNLTIIAHEECRERWDFHDGIDIGHICTFTRE-GEGAC 211
            |..|...|::|||..:.:..:...||.:.:.|:..|:|:|.: :...|..|.:|....| |:.||
  Fly   148 PAVGVQATISGWGYTKENGLSSDQLQQVKVPIVDSEKCQEAY-YWRPISEGMLCAGLSEGGKDAC 211

  Fly   212 SGDSGGPLMWEGKLVGLVNWGRACG-VGMPDMYANTVYYQDWIRR 255
            .|||||||:...||.|:|:||..|. ...|.:|||..||:|||.:
  Fly   212 QGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDWIAK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 74/234 (32%)
Tryp_SPc 35..256 CDD:238113 75/237 (32%)
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 74/234 (32%)
Tryp_SPc 28..257 CDD:238113 75/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.