DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and Jon44E

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:240 Identity:76/240 - (31%)
Similarity:113/240 - (47%) Gaps:19/240 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LDNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWILTAGHCALDFSIEDLRIIVGTNDR 95
            ::.||..|..|.:|..||.|.:......:.|.|.|::..|:|||.||.  .|...:.|..|.:.|
  Fly    37 IEGRITNGYPAYEGKIPYIVGLSFNDGGYWCGGSIIDHTWVLTAAHCT--NSANHVLIYFGASFR 99

  Fly    96 LEPGQTLFPDEALVHCLYDIPYVYNNDIALI---HVNESIIFNDRTQIVEL----SREQPPAGST 153
            .|...|.:...:.:....|.....|||||||   ||:...:.|.    |||    .|....:|..
  Fly   100 HEAQYTHWVSRSDMIQHPDWNDFLNNDIALIRIPHVDFWSLVNK----VELPSYNDRYNSYSGWW 160

  Fly   154 VTLTGWGAPESSYPTVQYLQTLNLTIIAHEECRERWDFHDGIDIGHICTFTREGEGACSGDSGGP 218
            ...:|||..:::.....||..:::.||.:.:||..:. .:.|....||..|..|:.:||||||||
  Fly   161 AVASGWGLTDNNSGMSNYLNCVDVQIIDNNDCRNYYG-SNYITDNTICINTDGGKSSCSGDSGGP 224

  Fly   219 LMW--EGKLVGLVNW--GRACGVGMPDMYANTVYYQDWIRRTHSG 259
            |:.  ..::||:|::  |..|..|.|..:.....|.||| |.|:|
  Fly   225 LVLHDNNRIVGIVSFGSGEGCTAGRPAGFTRVTGYLDWI-RDHTG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 71/229 (31%)
Tryp_SPc 35..256 CDD:238113 72/231 (31%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 71/229 (31%)
Tryp_SPc 41..266 CDD:238113 73/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.