DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and Phae2

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster


Alignment Length:274 Identity:80/274 - (29%)
Similarity:121/274 - (44%) Gaps:48/274 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIWLLLLGTSIDVTRGKRLDNRKLLDNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWI 71
            |..:|||...:....|..||..   :.|:|||:.|....|||.||:| ...||.|:..|:|..|:
  Fly     7 LATILLLAVCVSQGSGLALDQP---EGRVVGGKAAAANSAPYIVSMQ-YGGTHYCAANIINSNWL 67

  Fly    72 LTAGHCALDFS-------IEDLRIIVGTNDRLEPGQTLFPDEALVHCLY---DIPYVYNNDIALI 126
            :||.||..:.:       :.....:.||....:..|.   ...:::.||   .:||    ||.||
  Fly    68 VTAAHCLANRNQVLGSTLVAGSIAVAGTASTTQKRQI---THYVINDLYTGGTVPY----DIGLI 125

  Fly   127 HVNESIIFNDRTQIVELSREQPPAGSTVT----LTGWGAPES----SYP-TVQYLQTLNLTIIAH 182
            :...:..:......|:|    |.:|...|    |.|||:...    ||| |:|  :..|:.||:.
  Fly   126 YTPTAFTWTAAVAPVKL----PSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQ--EAKNIPIISL 184

  Fly   183 EEC-----RERWDFHDGIDIGHICTF-TREGEGACSGDSGGPLMWEGKLVGLVNWGR-ACG-VGM 239
            :.|     .:..|.|    ..::||. ...|...|:.||||||:....|:|:|:||: .|| ...
  Fly   185 DSCAAALGSKGQDVH----TTNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNS 245

  Fly   240 PDMYANTVYYQDWI 253
            |.:|.....:..||
  Fly   246 PSVYVQVSSFITWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 71/245 (29%)
Tryp_SPc 35..256 CDD:238113 72/246 (29%)
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 71/245 (29%)
Tryp_SPc 32..262 CDD:238113 72/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449493
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.