DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CG1304

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:259 Identity:82/259 - (31%)
Similarity:125/259 - (48%) Gaps:30/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WLLLLGTSIDVTRGKRLDNRKLLDNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWILT 73
            :||||...:....|.       |:.|:|||::|.....|:|||::.. .:|.|.|.||:..::||
  Fly    13 FLLLLAVPVHSAPGS-------LNGRVVGGEDAVKNQFPHQVSLRNA-GSHSCGGSILSRNYVLT 69

  Fly    74 AGHC---------ALDFSIEDLRIIVGTNDRLEPGQTLFPDEALVHCLYDIPYVYNNDIALIHVN 129
            |.||         ::..:.|...|..|:|||...|..:...|.:||..|.   .:.||:||:.:.
  Fly    70 AAHCVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYG---NFLNDVALLRLE 131

  Fly   130 ESIIFNDRTQIVELSREQPPAGSTVTLTGWGAPESSYPTVQYLQTLNLTIIAHEECRE--RWDFH 192
            ..:|.:...|.::|.....||...|.::|||..:......:|||...|..|:.|.|.|  .|   
  Fly   132 SPLILSASIQPIDLPTADTPADVDVIISGWGRIKHQGDLPRYLQYNTLKSISLERCDELIGW--- 193

  Fly   193 DGIDIGHICTFTREGEGACSGDSGGPLMWEGKLVGLVN--WGRACGVGMPDMYANTVYYQDWIR 254
             |:. ..:|.......|||:||||||.::..::||:..  |. |||...||.||...|:.:||:
  Fly   194 -GVQ-SELCLIHEADNGACNGDSGGPAVYNNQVVGVAGFVWS-ACGTSYPDGYARVYYHNEWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 74/231 (32%)
Tryp_SPc 35..256 CDD:238113 75/233 (32%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 74/231 (32%)
Tryp_SPc 32..256 CDD:238113 75/233 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.