DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and psh

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:275 Identity:67/275 - (24%)
Similarity:106/275 - (38%) Gaps:60/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KRLDNRK------LLDNRIVGGQEAEDGVAPYQVSIQ--TIWKTHICSGVILNEQWILTAGHCAL 79
            |::..||      .|...||||...:.||.|:..:|.  |......|.|.::..:::|||.||  
  Fly   126 KKIRERKQQRSGNQLVIHIVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHC-- 188

  Fly    80 DFSIEDLRIIVGTND------RLEPGQTLFPDEALVHCLYDI---------PYVYN--NDIALIH 127
                      |.|:.      ||.......||    |...||         .||.|  ||||::.
  Fly   189 ----------VNTDANTPAFVRLGAVNIENPD----HSYQDIVIRSVKIHPQYVGNKYNDIAILE 239

  Fly   128 VNESIIFND--RTQIVELSREQPPAGSTVTLTGWGAPE-SSYPTVQYLQTLNLTIIAHEECRERW 189
            :...::..|  |...:......||:.|...:.|||... ::....:.|....|.::..::|...:
  Fly   240 LERDVVETDNIRPACLHTDATDPPSNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISY 304

  Fly   190 D--------FHDGIDIGHICTFTRE-GEGACSGDSGGPLMWE-------GKLVGLVNWGRACGVG 238
            .        ...|:....:|...:: ...||.|||||||:.|       ..::|:::.|..|...
  Fly   305 AEQPGSIRLLKQGVIDSLLCAIDQKLIADACKGDSGGPLIHELNVEDGMYTIMGVISSGFGCATV 369

  Fly   239 MPDMYANTVYYQDWI 253
            .|.:|.....|.|:|
  Fly   370 TPGLYTRVSSYLDFI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 62/256 (24%)
Tryp_SPc 35..256 CDD:238113 63/257 (25%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 62/256 (24%)
Tryp_SPc 144..387 CDD:238113 63/257 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.