DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CG9673

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:270 Identity:78/270 - (28%)
Similarity:128/270 - (47%) Gaps:38/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RLSL-IWLLLLGTSIDVTRGKRLDNRKLLDNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILN 67
            |::| :.||:.|..:......:        .||:||::...|..|:..|:: ..|.|:|||.|::
  Fly     5 RITLGLGLLIFGLILSAEASPQ--------GRILGGEDVAQGEYPWSASVR-YNKAHVCSGAIIS 60

  Fly    68 EQWILTAGHCALDFSI-----EDLRIIVGTNDRLEPGQTLFPDEALVHCLYDIPYVYNNDIALIH 127
            ...||||.||.....|     ..|.:.:||.::...|..:.....::|..|.   .:.:|||::.
  Fly    61 TNHILTAAHCVSSVGITPVDASTLAVRLGTINQYAGGSIVNVKSVIIHPSYG---NFLHDIAILE 122

  Fly   128 VNESIIFNDRTQIVEL---SREQP-------PAGSTVTLTGWGAPESSYPTVQY-LQTLNLTIIA 181
            ::|:::|:||.|.:.|   :.|:.       |.|:.|.:.|||  |.|..|..| .|..|...::
  Fly   123 LDETLVFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWG--ELSDGTASYKQQKANYNTLS 185

  Fly   182 HEECRERWDFHDGIDIGHICTFTREGEGACSGDSGGPLMWEGKLV-GLV--NWGRACGVGMPDMY 243
            ...|  .|:...|.: ..:|....||||.|.||:|..::.:.|:: ||.  |:| .||...||:.
  Fly   186 RSLC--EWEAGYGYE-SVVCLSRAEGEGICRGDAGAAVIDDDKVLRGLTSFNFG-PCGSKYPDVA 246

  Fly   244 ANTVYYQDWI 253
            ....||..||
  Fly   247 TRVSYYLTWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 71/237 (30%)
Tryp_SPc 35..256 CDD:238113 72/238 (30%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 71/237 (30%)
Tryp_SPc 29..259 CDD:238113 72/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449455
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.