DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and sphe

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:266 Identity:78/266 - (29%)
Similarity:127/266 - (47%) Gaps:34/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVRLSLIWLLLLGTSIDVTRGKRLDNRKLLDNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVI 65
            |..||.::.|:.| |::.:...:         .||:||::|:.....:..|:: :...|:|.|.|
  Fly     2 MQPRLVILGLIGL-TAVGMCHAQ---------GRIMGGEDADATATTFTASLR-VDNAHVCGGSI 55

  Fly    66 LNEQWILTAGHCA------LDFSIEDLRIIVGTNDRLEPGQTLFPDEALVHCLYDIPYVYNNDIA 124
            |::..|||..||.      :|.|  .|...||:.::...|:.:..:...||..|   |..||::|
  Fly    56 LSQTKILTTAHCVHRDGKLIDAS--RLACRVGSTNQYAGGKIVNVESVAVHPDY---YNLNNNLA 115

  Fly   125 LIHVNESIIFNDRTQIVEL--SREQPPA-GSTVTLTGWGAPESSYPTVQY-LQTLNLTIIAHEEC 185
            :|.::..:.:.||...:.|  |.|..|| ||.|.:.|||  .:|..|..| ::.::|.:.....|
  Fly   116 VITLSSELTYTDRITAIPLVASGEALPAEGSEVIVAGWG--RTSDGTNSYKIRQISLKVAPEATC 178

  Fly   186 RERWDFHDGIDIGHICTFTREGEGACSGDSGGPLMWEGKLVGLVNW--GRACGVGMPDMYANTVY 248
            .:.:..||.   ...|......||.|.||.||..::...|:||.|:  | |||...||::.....
  Fly   179 LDAYSDHDE---QSFCLAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVG-ACGSRYPDVFVRLSS 239

  Fly   249 YQDWIR 254
            |.|||:
  Fly   240 YADWIQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 70/230 (30%)
Tryp_SPc 35..256 CDD:238113 71/232 (31%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 67/216 (31%)
Tryp_SPc 42..244 CDD:214473 65/213 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.