DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CG31220

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:260 Identity:64/260 - (24%)
Similarity:107/260 - (41%) Gaps:41/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NRIVGGQEAEDGVAPYQVSIQTIWKTH-----------ICSGVILNEQWILTAGHCALDFSIEDL 86
            ||::||.|......|:...:  :::..           .|.|.::|.:::|||.||..|..::..
  Fly   102 NRVIGGTEPNLNEYPWLAML--LYRNRSAFNPDRELVPSCGGSLINTRYVLTAAHCVTDTVLQIQ 164

  Fly    87 RIIVGTN------DRLEPGQTLF---------PDEALVHCLYD-IPYVYNNDIALIHVNESIIFN 135
            |:.:|.:      |.:..|..:.         .:....|..|| ..|.:.|||||:.:.|.:.:.
  Fly   165 RVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESITSHNDYDPANYTFRNDIALVRLKEPVRYT 229

  Fly   136 -DRTQIVELSREQPPAGSTVTLTGWGAPESSYPTVQYLQTLNLTIIAHEECRERWDF-HDGIDIG 198
             ....|..|...:......:.:.|||.........:.|:...:.:...|||.|::.. |.|... 
  Fly   230 MAYYPICVLDYPRSLMKFKMYVAGWGKTGMFDTGSKVLKHAAVKVRKPEECSEKYAHRHFGPRF- 293

  Fly   199 HICTFTREGEGACSGDSGGPLM-WEGK-------LVGLVNWGRACG-VGMPDMYANTVYYQDWIR 254
            .||....:..|.|.||||.||| ..|:       |.|:.::|..|| :|.|.::..|..:..|||
  Fly   294 QICAGGLDNRGTCDGDSGSPLMGTSGRSYETITFLAGITSYGGPCGTIGWPSVFTRTAKFYKWIR 358

  Fly   255  254
              Fly   359  358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 60/256 (23%)
Tryp_SPc 35..256 CDD:238113 62/258 (24%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 60/256 (23%)
Tryp_SPc 104..360 CDD:238113 62/258 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.