DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CG8952

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:285 Identity:79/285 - (27%)
Similarity:127/285 - (44%) Gaps:49/285 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVRLSLIWLLLLGTSIDVTRGKRLDNRK----LLDNRIVGGQEAEDGVAPYQVSI-QTIWKTHI 60
            ||:......:|:|..:|.|. |:..|...    .:|||||.|.:|:.|..|:||.: :..|...:
  Fly     1 MALNSERSLMLVLLAAISVV-GQPFDPANSSPIKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLL 64

  Fly    61 CSGVILNEQWILTAGHCALDFSIEDLRIIVGTNDRLEPGQTLFPDEAL--------VHCLYDIPY 117
            |.|.|:::.|:|||.||....|  .:.::.||.|       ||...||        :|..|:.. 
  Fly    65 CGGSIISDTWVLTAAHCTNGLS--SIFLMFGTVD-------LFNANALNMTSNNIIIHPDYNDK- 119

  Fly   118 VYNNDIALIHVNESIIFNDRTQIVELSREQPPA----GSTVTLTGWGAPESSYPTVQYLQTL--- 175
             .|||::||.:.|.:.|:...|.::|..:...:    ||..|:.|:|..|..|  :.|.:||   
  Fly   120 -LNNDVSLIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYTEDEY--LDYSETLLYA 181

  Fly   176 NLTIIAHEECRERWDFHDGIDIGHICT--FTREGEGACSGDSGGPLMWEGKLVGLVNWGR----- 233
            .:.||.:.:|...:..:..:| ..:|.  |.......|:|||||||:...|.:  ..|.:     
  Fly   182 QVEIIDNADCVAIYGKYVVVD-STMCAKGFDGSDMSTCTGDSGGPLILYNKTI--QQWQQIGINS 243

  Fly   234 -----ACGVGMPDMYANTVYYQDWI 253
                 .|...:|..||....:..:|
  Fly   244 FVAEDQCTYRLPSGYARVSSFLGFI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 68/246 (28%)
Tryp_SPc 35..256 CDD:238113 68/247 (28%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 68/246 (28%)
Tryp_SPc 38..271 CDD:238113 68/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.