DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CG31269

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:266 Identity:118/266 - (44%)
Similarity:158/266 - (59%) Gaps:19/266 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SLIWLLLLGTS--IDVT----RGKRLDNRKLLDNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGV 64
            :::.|:|||.|  :.:|    :|...|.|...|.||:|||.||||.||||:|:|.|...|.|.|.
  Fly     3 AVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGA 67

  Fly    65 ILNEQWILTAGHCALDFSIEDLRIIVGTNDRLEPGQTLFPDEALVHCLYDIPYVYNNDIALIHVN 129
            |:||.::|||.||..:..|..|.::.|||...:||...|.....:||.||.|.:: |||||:.:.
  Fly    68 IINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMH-NDIALLELV 131

  Fly   130 ESIIFNDRTQIVELSREQPPAGSTVTLTGWGAPESSYPTVQY------LQTLNLTIIAHEECRER 188
            |.|.:::|||.:.|.......|..|.|||||:      ||.:      ||.|.|..:.|.||:..
  Fly   132 EPIAWDERTQPIPLPLVPMQPGDEVILTGWGS------TVLWGTSPIDLQVLYLQYVPHRECKAL 190

  Fly   189 WDFHDGIDIGHICTFTREGEGACSGDSGGPLMWEGKLVGLVNWGRACGVGMPDMYANTVYYQDWI 253
            ....:..|:||||||:|.|||||.|||||||:..|.||||||||..|..|:||::|:..:|:|||
  Fly   191 LSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCATGVPDVHASVYFYRDWI 255

  Fly   254 RRTHSG 259
            |...||
  Fly   256 RNVMSG 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 103/224 (46%)
Tryp_SPc 35..256 CDD:238113 105/226 (46%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 103/224 (46%)
Tryp_SPc 38..258 CDD:238113 105/226 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449453
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D104368at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.