DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CG11664

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:219 Identity:54/219 - (24%)
Similarity:90/219 - (41%) Gaps:28/219 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 YQVSIQTIWKTHICSGVILNEQWILTAGHC-ALDFSIEDLRIIVG-------TNDRLEPGQTLFP 104
            |...:|......:.:|.:.:.:::||..|| ..:...|:|.:..|       ...:...|....|
  Fly    34 YGYVMQIYGPQFLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAWEFRGKQVAGLLRHP 98

  Fly   105 DEALVHCLYDIPYVYNNDIALIHVNESIIFNDRTQIVEL-SREQPPAGSTV---TLTGWGAPESS 165
            ..:        |....||||::.|..:|..:.....:.| ||...|.....   .|.||.....:
  Fly    99 KFS--------PLTLRNDIAVLRVKAAISHSHMINYIGLCSRPLTPLNMFAPPQELAGWNLMHIA 155

  Fly   166 YPTVQYLQTLNLTIIAHEECRERWDFHDGIDIGHICTFTREGEGACSGDSGGPLMWEGKLVGLVN 230
            .|    |:::::.:...:.||: |  ...|..|.||.....|||.|.||||.||:..|::.||..
  Fly   156 QP----LKSMSVQVEPEKNCRQ-W--FPQISGGVICASATMGEGLCYGDSGDPLISGGEVCGLAI 213

  Fly   231 WGRACG-VGMPDMYANTVYYQDWI 253
            ..|.|| ...|.::.:..|::.:|
  Fly   214 AFRKCGDKRYPALFTDVHYHRAFI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 53/217 (24%)
Tryp_SPc 35..256 CDD:238113 54/219 (25%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 53/215 (25%)
Tryp_SPc 38..237 CDD:214473 52/213 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.