DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and Klk1c3

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001258244.1 Gene:Klk1c3 / 292872 RGDID:735032 Length:255 Species:Rattus norvegicus


Alignment Length:263 Identity:72/263 - (27%)
Similarity:136/263 - (51%) Gaps:31/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IWLLLLGTSIDVTRGKRLDNRKLLDNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWIL 72
            :|.|:|..::.:   .::|......:|:|||.:.|....|:||:   :....:|.||:::..|::
  Rat     1 MWFLILFLALSL---GQIDAAPPGQSRVVGGFKCEKNSQPWQVA---VINEDLCGGVLIDPSWVI 59

  Fly    73 TAGHCALDFSIEDLRIIVGTNDRLEPGQTLFPDEALVHCLYDIPYV----------YNNDIALIH 127
            ||.||..|    :..:::|.|:..|..|.....::..|..|. |::          |:||:.|:|
  Rat    60 TAAHCYSD----NYHVLLGQNNLSEDVQHRLVSQSFRHPDYK-PFLMRNHTRKPKDYSNDLMLLH 119

  Fly   128 VNESIIFNDRTQIVELSREQPPAGSTVTLTGWGAPESS---YPTVQYLQTLNLTIIAHEECRERW 189
            ::|.....|..::::|..::|..|||..::|||:...|   :|  ..||.:|:.::::|:|.:. 
  Rat   120 LSEPADITDGVKVIDLPTKEPKVGSTCLVSGWGSTNPSEWEFP--DDLQCVNIHLLSNEKCIKA- 181

  Fly   190 DFHDGIDIGHICTFTRE-GEGACSGDSGGPLMWEGKLVGLVNWGRA-CG-VGMPDMYANTVYYQD 251
             :.:.:....:|....| |:..|.|||||||:.:|.|.|:.:||.. || ...|.:|...:.:..
  Rat   182 -YKEKVTDLMLCAGELEGGKDTCRGDSGGPLICDGVLQGITSWGSVPCGEPNKPGIYTKLIKFTS 245

  Fly   252 WIR 254
            ||:
  Rat   246 WIK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 66/234 (28%)
Tryp_SPc 35..256 CDD:238113 67/236 (28%)
Klk1c3NP_001258244.1 Tryp_SPc 24..247 CDD:214473 66/234 (28%)
Tryp_SPc 25..250 CDD:238113 67/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341251
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.