DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and Klk1c9

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_786935.1 Gene:Klk1c9 / 292868 RGDID:727805 Length:259 Species:Rattus norvegicus


Alignment Length:266 Identity:75/266 - (28%)
Similarity:138/266 - (51%) Gaps:31/266 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IWLLLLGTSIDVTRGKRLDNRKLLDNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWIL 72
            :|.|:|..::.:   .::|......:|:|||...|....|:||:   :..|..|.||:::..|::
  Rat     1 MWFLILFLALSL---GQIDAAPPGQSRVVGGYNCETNSQPWQVA---VIGTTFCGGVLIDPSWVI 59

  Fly    73 TAGHCALDFSIEDLRIIVGTNDRL--EP-GQTLFPDEALVHCLYDIP-----------YVYNNDI 123
            ||.||   :| ::.|:::|.|:.:  || .|.....::..|..| ||           |.:|||:
  Rat    60 TAAHC---YS-KNYRVLLGRNNLVKDEPFAQRRLVSQSFQHPDY-IPVFMRNHTRQRAYDHNNDL 119

  Fly   124 ALIHVNESIIFNDRTQIVELSREQPPAGSTVTLTGWGAPESSYPTVQY-LQTLNLTIIAHEECRE 187
            .|:|:::........::::|..|:|..||....:|||....|...:.: ||.:|:.::::|:|.|
  Rat   120 MLLHLSKPADITGGVKVIDLPTEEPKVGSICLASGWGMTNPSEMKLSHDLQCVNIHLLSNEKCIE 184

  Fly   188 RWDFHDGIDIGHICTFTRE-GEGACSGDSGGPLMWEGKLVGLVNWGRA-CG-VGMPDMYANTVYY 249
            .:. :...|: .:|....: |:..|:|||||||:.:|.|.||.:.|.. |. ...|.:||..:.:
  Rat   185 TYK-NIETDV-TLCAGEMDGGKDTCTGDSGGPLICDGVLQGLTSGGATPCAKPKTPAIYAKLIKF 247

  Fly   250 QDWIRR 255
            ..||::
  Rat   248 TSWIKK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 69/236 (29%)
Tryp_SPc 35..256 CDD:238113 70/239 (29%)
Klk1c9NP_786935.1 Tryp_SPc 24..251 CDD:214473 69/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341253
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.