DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and Klk7

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_017444408.1 Gene:Klk7 / 292852 RGDID:1306420 Length:249 Species:Rattus norvegicus


Alignment Length:262 Identity:75/262 - (28%)
Similarity:133/262 - (50%) Gaps:33/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IWLL-----LLGTSIDVTRGKRLDNRKLLDNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILN 67
            :|||     ||..::: |.|:        ..||:.|.:.::|..|:||::....:.| |.||::.
  Rat     3 VWLLSLLTVLLSLALE-TAGQ--------GERIIDGYKCKEGSHPWQVALLKGDQLH-CGGVLVG 57

  Fly    68 EQWILTAGHCALDFSIEDLRIIVGTNDRLE--PGQTLFPDEALVHCLYDIPYVYNNDIALIHVNE 130
            |.|:|||.||.:.    ...:.:| :|::|  ..|.:....:..|..|. ...:.|||.|:.:::
  Rat    58 ESWVLTAAHCKMG----QYTVHLG-SDKIEDQSAQRIKASRSFRHPGYS-TRTHVNDIMLVKMDK 116

  Fly   131 SIIFNDRTQIVELSREQPPAGSTVTLTGWG---APESSYPTVQYLQTLNLTIIAHEECRERWDFH 192
            .:..:|:.|.|:|.....|.|:..|::|||   :|:.::|:  .|...::.:|:.:||::  .:.
  Rat   117 PVKMSDKVQKVKLPDHCEPPGTLCTVSGWGTTTSPDVTFPS--DLMCSDVKLISSQECKK--VYK 177

  Fly   193 DGIDIGHICTFTREGE-GACSGDSGGPLMWEGKLVGLVNWGR-ACG-VGMPDMYANTVYYQDWIR 254
            |.:....:|....:.: ..|:|||||||:....|.|||:||. .|| ...|.:|.....||.|:.
  Rat   178 DLLGKTMLCAGIPDSKTNTCNGDSGGPLVCNDTLQGLVSWGTYPCGQPNDPGVYTQVCKYQRWLE 242

  Fly   255 RT 256
            .|
  Rat   243 DT 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 66/226 (29%)
Tryp_SPc 35..256 CDD:238113 66/228 (29%)
Klk7XP_017444408.1 Tryp_SPc 25..240 CDD:214473 66/225 (29%)
Tryp_SPc 26..244 CDD:238113 66/228 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341249
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.