DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and Prss2

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_036861.1 Gene:Prss2 / 25052 RGDID:3418 Length:246 Species:Rattus norvegicus


Alignment Length:259 Identity:79/259 - (30%)
Similarity:131/259 - (50%) Gaps:27/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SLIWLLLLGTSIDVTRGKRLDNRKLLDNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQW 70
            :|::|.|:|.::...    :|:    |::||||...::...|||||:.:.:  |.|.|.::|:||
  Rat     3 ALLFLALVGAAVAFP----VDD----DDKIVGGYTCQENSVPYQVSLNSGY--HFCGGSLINDQW 57

  Fly    71 ILTAGHCALDFSIEDLRIIVGT-NDRLEPGQTLFPDEALV--HCLYDIPYVYNNDIALIHVNESI 132
            :::|.||..    ..:::.:|. |..:..|...|.:.|.:  |..:| ....||||.||.::..:
  Rat    58 VVSAAHCYK----SRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFD-RKTLNNDIMLIKLSSPV 117

  Fly   133 IFNDRTQIVELSREQPPAGSTVTLTGWGAPESS---YPTVQYLQTLNLTIIAHEECRERWDFHDG 194
            ..|.|...|.|.....|||:...::|||...||   .|.:  ||.|:..::...:|..  .:...
  Rat   118 KLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDL--LQCLDAPLLPQADCEA--SYPGK 178

  Fly   195 IDIGHICT-FTREGEGACSGDSGGPLMWEGKLVGLVNWGRACGV-GMPDMYANTVYYQDWIRRT 256
            |....:|. |...|:.:|.||||||::..|:|.|:|:||..|.: ..|.:|.....|.|||:.|
  Rat   179 ITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDT 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 70/226 (31%)
Tryp_SPc 35..256 CDD:238113 72/228 (32%)
Prss2NP_036861.1 Tryp_SPc 23..239 CDD:214473 70/226 (31%)
Tryp_SPc 24..242 CDD:238113 72/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.