DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and Klk1c2

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_036809.1 Gene:Klk1c2 / 24841 RGDID:3888 Length:259 Species:Rattus norvegicus


Alignment Length:273 Identity:77/273 - (28%)
Similarity:137/273 - (50%) Gaps:45/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IWLLLLGTSIDVTRGKRLDNRKLLDNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWIL 72
            :||.:|...:.|   .|:|......:|||||.:.|....|:||:   :...::|.||:::..|::
  Rat     1 MWLQILSLVLSV---GRIDAAPPGQSRIVGGYKCEKNSQPWQVA---VINEYLCGGVLIDPSWVI 59

  Fly    73 TAGHCALDFSIEDLRIIVGTNDRLEPGQTLFPDEALV----------HCLYDIPYV--------- 118
            ||.||   :| .:.::::|.|:       ||.||...          |..| ||.:         
  Rat    60 TAAHC---YS-NNYQVLLGRNN-------LFKDEPFAQRRLVRQSFRHPDY-IPLIVTNDTEQPV 112

  Fly   119 --YNNDIALIHVNESIIFNDRTQIVELSREQPPAGSTVTLTGWGAPESSYPTVQY-LQTLNLTII 180
              ::||:.|:|::|........::::|..::|..|||...:|||:...|...|.: ||.:|:.::
  Rat   113 HDHSNDLMLLHLSEPADITGGVKVIDLPTKEPKVGSTCLASGWGSTNPSEMVVSHDLQCVNIHLL 177

  Fly   181 AHEECRERWDFHDGIDIGHICTFTRE-GEGACSGDSGGPLMWEGKLVGLVNWGRA-CG-VGMPDM 242
            ::|:|.|  .:.|.:....:|....| |:..|:|||||||:.:|.|.|:.:.|.. |. ...|.:
  Rat   178 SNEKCIE--TYKDNVTDVMLCAGEMEGGKDTCAGDSGGPLICDGVLQGITSGGATPCAKPKTPAI 240

  Fly   243 YANTVYYQDWIRR 255
            ||..:.:..||::
  Rat   241 YAKLIKFTSWIKK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 69/243 (28%)
Tryp_SPc 35..256 CDD:238113 70/246 (28%)
Klk1c2NP_036809.1 Tryp_SPc 24..251 CDD:214473 69/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341248
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.