DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CG30187

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:292 Identity:76/292 - (26%)
Similarity:125/292 - (42%) Gaps:65/292 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVRLS----LIWLLL-LGTSIDVTRGKRLDNRKLLDN--------RIVGGQEAEDGVAPYQVSI 52
            |..||:    :.|.|. :|.||            .||.        :|.||..     |.:|   
  Fly     1 MQTRLAWIPVIFWFLKDVGASI------------FLDQICGINIALKITGGHN-----AAFQ--- 45

  Fly    53 QTIW------KTH-ICSGVILNEQWILTAGHCALDFSIEDLRIIVGTNDRLEPGQTLFPDEALVH 110
            .::|      :|| ||.|.:::::::|||.||.:|..::.  :.:|..::.:|........|:||
  Fly    46 NSVWMAAVHNRTHFICGGTLIHKRFVLTAAHCIVDQDVQS--VSLGAYNKSDPADRKDVITAVVH 108

  Fly   111 CLYDIPYVYNNDIALIHVNESIIFNDRTQIVELSREQPPAG-----STVTLTGWGAPESSYPTVQ 170
            ..:|:...|.|||.|:.::..:|||...:.:.:...:..|.     .|....|||....: .|..
  Fly   109 SSFDVRASYENDIGLLKLSSDVIFNALIRPICIVLNKSMANHMRNMRTFKAFGWGTLRGN-KTSD 172

  Fly   171 YLQTLNLTIIAHEECRERWDFHDGIDIGHICTFTREGEGACSGDSGGPLMWEGKLVGL----VNW 231
            .|||:.|..:..|||......:....  .||.....|: .|.|||||||..:..:.|:    |.:
  Fly   173 ILQTIILNHLDREECYMELSVYPSEK--QICAGVPSGD-TCGGDSGGPLTNDVFIQGIGNREVQF 234

  Fly   232 G------RAC-GVGMPDMYANTVYYQDWIRRT 256
            |      .:| |.|   :|.:.:.:.|||:.|
  Fly   235 GIISVGKTSCDGQG---VYTDLMSFADWIKMT 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 63/241 (26%)
Tryp_SPc 35..256 CDD:238113 65/243 (27%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 63/241 (26%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.