DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CG30091

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:287 Identity:73/287 - (25%)
Similarity:120/287 - (41%) Gaps:56/287 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WLLLLGTSIDVTRGKRLDNRKLLDN----------RIVGGQEAEDGVAPYQVSIQTIWKTHICSG 63
            |::|....:...||    :.:|||.          :||||.:|.:...|:...|:|. ...||.|
  Fly     5 WVVLFAWMLTAGRG----SARLLDEDCGVPMQLIPKIVGGVDAGELKNPWMALIKTN-DEFICGG 64

  Fly    64 VILNEQWILTAGHCALD-----FSIEDLRIIVGTNDRLEPGQTLFPDEALVHCLYDIPYV----- 118
            .::..:::|||.||...     .....|.:.:|....|..|:...|     |.:|::..|     
  Fly    65 SVITNKFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEHNHP-----HEIYNVERVYIHDS 124

  Fly   119 -----YNNDIALIHVNESIIFNDRTQ--IVELSREQPPAGSTV---TLTGWGAPESSYPTVQYLQ 173
                 |.|||||:.:.:||::..:.:  .:.|:.:..|....:   |..|||...:...: ..||
  Fly   125 FAIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTGNGKMS-NNLQ 188

  Fly   174 TLNLTIIAHEECRERWDFHDGIDIGHICTFTREGEGACSGDSGGPL----MWEG----KLVGLVN 230
            .:.:..|..:.|...  |....|....|..|..|...|..||||||    :::|    ..:|:|:
  Fly   189 MVKIYRIDRKMCEAA--FWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVS 251

  Fly   231 WG-RAC-GVGMPDMYANTVYYQDWIRR 255
            .| ..| |.|   ||.:.:.:.|:|.|
  Fly   252 TGTEDCRGFG---MYTDVMGHIDFIER 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 64/248 (26%)
Tryp_SPc 35..256 CDD:238113 66/251 (26%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 64/248 (26%)
Tryp_SPc 37..276 CDD:238113 66/251 (26%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.