DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CG30087

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:288 Identity:86/288 - (29%)
Similarity:132/288 - (45%) Gaps:51/288 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VRLSLIWLLLLGTSIDVTRGKRLDNRKLLD------------NRIVGGQEAEDGVAPYQVSIQTI 55
            ::.|..|.::   :|.:.|.:|:.:.:.|:            .|:|.|:||....||:.|.:...
  Fly     1 MKTSPAWFVI---AICLIRQQRIVDAQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNN 62

  Fly    56 WKTHICSGVILNEQWILTAGHCALDFSIEDLRIIVGT-NDRLEP---GQTLFPD-------EALV 109
            ..|| |.|.|||.::||||.||.    ..:||:.:|. |.|.:|   |....|.       :|:.
  Fly    63 SLTH-CGGSILNSRYILTAAHCV----FPNLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAIT 122

  Fly   110 HCLYDIPYVYNNDIALIHVNESIIFNDRTQ--IVELSREQPPAGSTVTLTGWG-APESSYPTVQY 171
            |..|:... :.|||||:.:|.||.||...|  .:.|:....|:.:|....||| ..::.:|  ..
  Fly   123 HRFYNAAN-HVNDIALLKLNRSINFNVHIQPICILLNPASAPSVATYQTFGWGETKKNGFP--HL 184

  Fly   172 LQTLNLTIIAHEECRERWDFHDGIDIGHICTFTREGEGACSGDSGGPLM----WEG----KLVGL 228
            |||..|.......|..  .||..::...||. ..|....|:|||||||:    ::|    ..:|:
  Fly   185 LQTAELRAYDAAYCSR--SFHAYMNGNQICA-GHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGI 246

  Fly   229 VNWGRA-CGVGMPDMYANTVYYQDWIRR 255
            |::|.. |  ..|.:|.....|.:||||
  Fly   247 VSYGPTDC--QSPGVYTYVPNYINWIRR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 76/241 (32%)
Tryp_SPc 35..256 CDD:238113 79/244 (32%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 76/241 (32%)
Tryp_SPc 42..272 CDD:238113 77/242 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.