DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CG30025

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster


Alignment Length:228 Identity:74/228 - (32%)
Similarity:113/228 - (49%) Gaps:10/228 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LDNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWILTAGHCALDFSIEDLRIIVGTNDR 95
            ||.|||||........|:|:|:|.. .:|.|.|.|.:...|:||.||....|...|:|..|::..
  Fly    27 LDGRIVGGSATTISSFPWQISLQRS-GSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYW 90

  Fly    96 LEPGQTLFPDEALVHCLYDIPYVYNNDIALIHVNESIIFNDRTQIVELSREQPPAGSTVTLTGWG 160
            ...|.|........|..|:...:. ||||:|.:|.::.|:...:.:.|:...|..|:..:::|||
  Fly    91 SSGGVTFSVSSFKNHEGYNANTMV-NDIAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWG 154

  Fly   161 A---PESSYPTVQYLQTLNLTIIAHEEC-RERWDFHDGIDIGHICTFTREGEGACSGDSGGPLMW 221
            .   ..||.|:  .||.:|:.|::..:| ...:.:...|....||. ...|:.||.|||||||:.
  Fly   155 TLSYGSSSIPS--QLQYVNVNIVSQSQCASSTYGYGSQIRSTMICA-AASGKDACQGDSGGPLVS 216

  Fly   222 EGKLVGLVNWGRACGV-GMPDMYANTVYYQDWI 253
            .|.|||:|:||..|.. ..|.:||:....:.|:
  Fly   217 GGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 71/223 (32%)
Tryp_SPc 35..256 CDD:238113 71/224 (32%)
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 71/223 (32%)
Tryp_SPc 31..252 CDD:238113 71/224 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.