DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and Prss38

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001038986.1 Gene:Prss38 / 216797 MGIID:2685095 Length:322 Species:Mus musculus


Alignment Length:282 Identity:77/282 - (27%)
Similarity:125/282 - (44%) Gaps:44/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIWLLLLG-----TSIDVTRGKRLDN---------RKLLDNRIVGGQEAEDGVAPYQVSIQTIWK 57
            |::.|||.     ||:.....|...|         :.:|..:::||:.|.|...|:|||:. ...
Mouse    14 LLFPLLLASPTWVTSVSRRHPKSQANSLSGDVACGQPVLQGKLLGGEFARDRKWPWQVSLH-YSG 77

  Fly    58 THICSGVILNEQWILTAGHCALDF----SIEDLRIIVG-TNDRLEPGQTLFPD--EALVHCLYDI 115
            .|||.|.||:..|:|:|.||   |    .:|...|.|| ||.......|.:.:  :.::|..:.:
Mouse    78 FHICGGSILSAYWVLSAAHC---FDRGKKLETYDIYVGITNLEKANRHTQWFEIYQVIIHPTFQM 139

  Fly   116 PYVYNNDIALIHVNESIIFNDRTQIVELSREQPPA-----GSTVTLTGWGAPESSYPTVQYLQTL 175
            .:....|:||:.:..:|:|:|....:.|    ||:     ..:...||||.......|...|...
Mouse   140 YHPIGGDVALVQLKSAIVFSDFVLPICL----PPSDLYLINLSCWTTGWGMISPQGETGNELLEA 200

  Fly   176 NLTIIAHEECRERWDFHDGIDIGHICTF-TREGEGACSGDSGGPLM------WEGKLVGLVNWGR 233
            .|.:|...:|:..:.....:....:|.. .:..:..|.||||.||:      |  ..:|:|:|||
Mouse   201 QLPLIPRFQCQLLYGLSSYLLPEMLCAADIKTMKNVCEGDSGSPLVCKQNQTW--LQIGIVSWGR 263

  Fly   234 ACGVGM-PDMYANTVYYQDWIR 254
            .|...: |.::||..|:..|||
Mouse   264 GCAQPLYPGVFANVSYFLSWIR 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 65/238 (27%)
Tryp_SPc 35..256 CDD:238113 68/240 (28%)
Prss38NP_001038986.1 Tryp_SPc 58..287 CDD:238113 68/238 (29%)
Tryp_SPc 58..284 CDD:214473 65/235 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.