DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and Prtn3

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_035308.2 Gene:Prtn3 / 19152 MGIID:893580 Length:254 Species:Mus musculus


Alignment Length:275 Identity:77/275 - (28%)
Similarity:122/275 - (44%) Gaps:56/275 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIWLLLLGTSIDVTRGKRLDNRKLLDNRIVGGQEAEDGVAPYQVSIQ--TIWKTHICSGVILNEQ 69
            |:..|::|.::..             ::||||.||.....||..|:|  ....:|.|.|.:::.:
Mouse    15 LLLALVVGGAVQA-------------SKIVGGHEARPHSRPYVASLQLSRFPGSHFCGGTLIHPR 66

  Fly    70 WILTAGHCALDFSIEDLRIIVGTNDRL--EPGQTLF-----------PDEALVHCLYDIPYVYNN 121
            ::|||.||..|.|.:.:.:::|.:|.|  ||.|..|           |:|.|            |
Mouse    67 FVLTAAHCLQDISWQLVTVVLGAHDLLSSEPEQQKFTISQVFQNNYNPEENL------------N 119

  Fly   122 DIALIHVNESIIFNDRTQIVELSREQP--PAGSTVTLTGWGAPESSYPTVQYLQTLNLTIIAHEE 184
            |:.|:.:|.:........:..|.::..  ..|:.....|||...:..||.:.||.||:|::.. .
Mouse   120 DVLLLQLNRTASLGKEVAVASLPQQDQTLSQGTQCLAMGWGRLGTQAPTPRVLQELNVTVVTF-L 183

  Fly   185 CRERWDFHDGIDIGHICTFT-REGEGACSGDSGGPLMWEGKLVGLVNWG-RAC-GVGMPDMYANT 246
            |||.          ::||.. |...|.|.|||||||:..|.|.|:.::. |.| .:..||.:|..
Mouse   184 CREH----------NVCTLVPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARV 238

  Fly   247 VYYQDWIRRTHSGCK 261
            ..|.|||:....|.:
Mouse   239 SMYVDWIQNVLRGAE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 71/238 (30%)
Tryp_SPc 35..256 CDD:238113 73/240 (30%)
Prtn3NP_035308.2 Tryp_SPc 29..245 CDD:214473 71/238 (30%)
Tryp_SPc 30..248 CDD:238113 73/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.