DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and Klk1b27

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_064664.1 Gene:Klk1b27 / 16619 MGIID:891980 Length:263 Species:Mus musculus


Alignment Length:248 Identity:70/248 - (28%)
Similarity:123/248 - (49%) Gaps:20/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LDNRKLLDNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWILTAGHC-ALDFSIEDLRI 88
            :|....:.:||:||.:.:....|:.|::....| :||.||:|:..|:|||.|| ..|.|..:  :
Mouse    15 IDAAPPVQSRIIGGFKCKKNSQPWHVAVLRSNK-YICGGVLLDPNWVLTAAHCYGNDTSQHN--V 76

  Fly    89 IVGTND--RLEP-GQTLFPDEALVHCLYDI---------PYVYNNDIALIHVNESIIFNDRTQIV 141
            .:|.|.  :.|| .|..:..::..|..|::         |...:||:.|:.:::.....|..:.:
Mouse    77 WLGKNKLFQREPSAQHRWVSKSFPHPDYNMSLLNDHIPHPEDKSNDLMLLRLSKPADITDAVKPI 141

  Fly   142 ELSREQPPAGSTVTLTGWGA-PESSYPTVQYLQTLNLTIIAHEECRERWDFHDGIDIGHICTFTR 205
            :|..|:|..|||...:|||: ..:.|.....||.:.:.::.:|.|.:.: .|...|:......|.
Mouse   142 DLPTEEPKLGSTCLASGWGSITPTKYQIPNDLQCVFIKLLPNENCAKAY-VHKVTDVMLCVGETG 205

  Fly   206 EGEGACSGDSGGPLMWEGKLVGLVNWGR-ACG-VGMPDMYANTVYYQDWIRRT 256
            .|:|.|.|||||||:.:|.|.|:.:||. .|. ...|.::...:.:..||:.|
Mouse   206 GGKGTCKGDSGGPLICDGVLHGITSWGSIPCAKPNAPGVFTKLIKFTSWIKDT 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 66/234 (28%)
Tryp_SPc 35..256 CDD:238113 67/236 (28%)
Klk1b27NP_064664.1 Tryp_SPc 24..255 CDD:214473 66/234 (28%)
Tryp_SPc 25..258 CDD:238113 67/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837543
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.