DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CG43742

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:231 Identity:55/231 - (23%)
Similarity:101/231 - (43%) Gaps:46/231 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 CSGVILNEQWILTAGHCALDFSIEDLRIIVGTNDRLEPGQTLFP---------DEALVHCLYDIP 116
            |.|.::::|::|||.||..|  ::::.:.:|.|:|..|    .|         .:.::|..:. .
  Fly    58 CGGSLIHKQYVLTAAHCVRD--LDEVTVHLGENNRSCP----IPVCKHVLRLNAKVILHPNFH-G 115

  Fly   117 YVYNNDIALIHVNESIIFNDRTQIVELSREQPPAG---STVTLTGWGAPESSYPTVQYLQTLNLT 178
            .::.|||||:.:...:||....:.:.:..::....   :..|..|||..|....: ..|..::|.
  Fly   116 NIFLNDIALLRLEREVIFEAHIRPICIILDEDVTSNNQNNFTAYGWGKTEHGNIS-DVLSFIDLV 179

  Fly   179 IIAHEECRERWDFHDGIDIGHICTFTREGEGACSGDSGGPL----MWEGK----LVGLVNWGRAC 235
            .:....|.:        :|..||..:..|: .|..||||||    :..||    |.|:.::|.|.
  Fly   180 RLPKSMCYQ--------NINTICAGSTSGD-TCESDSGGPLIGNFVHRGKSRDILFGITSYGDAE 235

  Fly   236 GVGMPDMYANTVYYQDWI---------RRTHSGCKN 262
            ..|:..:|.:...|:.||         |..:..||:
  Fly   236 CSGLFGVYTDVNAYKSWIASVVLESEPRLLNEYCKS 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 50/211 (24%)
Tryp_SPc 35..256 CDD:238113 53/223 (24%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 50/211 (24%)
Tryp_SPc 35..256 CDD:238113 52/214 (24%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.