DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and PRSS58

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001001317.1 Gene:PRSS58 / 136541 HGNCID:39125 Length:241 Species:Homo sapiens


Alignment Length:223 Identity:54/223 - (24%)
Similarity:100/223 - (44%) Gaps:33/223 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PYQVSIQTIWKTHICSGVILNEQWILTAGHCALDFSIEDLRIIVGTN---DRLEPGQTLFPDEAL 108
            ||.|.:::.:..  |:||:::..|::||.||    ::..||:|:|..   |..|....:...|.:
Human    29 PYLVYLKSDYLP--CAGVLIHPLWVITAAHC----NLPKLRVILGVTIPADSNEKHLQVIGYEKM 87

  Fly   109 VHCLYDIPYVYNNDIALIHVNESIIFNDRTQIVELSREQPPAGSTVTLTGWG--------APESS 165
            :|..:......::||.||.:......||..::..|..:.....:..:::.|.        .|:| 
Human    88 IHHPHFSVTSIDHDIMLIKLKTEAELNDYVKLANLPYQTISENTMCSVSTWSYNVCDIYKEPDS- 151

  Fly   166 YPTVQYLQTLNLTIIAHEECRERWDFHDGIDIGHICTFTREG-EGACSGDSGGPLMWEGKLVGLV 229
                  |||:|:::|:..:||:.:..:: |....:|.....| ...|...|..|.:..|.|.|::
Human   152 ------LQTVNISVISKPQCRDAYKTYN-ITENMLCVGIVPGRRQPCKEVSAAPAICNGMLQGIL 209

  Fly   230 NWGRAC----GVGMPDMYANTVYYQDWI 253
            ::...|    .||   :||...||..||
Human   210 SFADGCVLRADVG---IYAKIFYYIPWI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 52/221 (24%)
Tryp_SPc 35..256 CDD:238113 54/223 (24%)
PRSS58NP_001001317.1 Tryp_SPc 29..234 CDD:214473 52/221 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147491
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.